TUBA2 monoclonal antibody (M01), clone 3F10-2F2 View larger

TUBA2 monoclonal antibody (M01), clone 3F10-2F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TUBA2 monoclonal antibody (M01), clone 3F10-2F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about TUBA2 monoclonal antibody (M01), clone 3F10-2F2

Brand: Abnova
Reference: H00007278-M01
Product name: TUBA2 monoclonal antibody (M01), clone 3F10-2F2
Product description: Mouse monoclonal antibody raised against a full length recombinant TUBA2.
Clone: 3F10-2F2
Isotype: IgG1 kappa
Gene id: 7278
Gene name: TUBA3C
Gene alias: TUBA2|bA408E5.3
Gene description: tubulin, alpha 3c
Genbank accession: BC011721
Immunogen: TUBA2 (AAH11721.1, 1 a.a. ~ 418 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDLAALEKDYEEVGVDSVEAEAEEGEEY
Protein accession: AAH11721.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007278-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (71.72 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007278-M01-3-12-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to TUBA2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TUBA2 monoclonal antibody (M01), clone 3F10-2F2 now

Add to cart