> >>TUB polyclonal antibody (A01)
TUB polyclonal antibody (A01) View larger

TUB polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of TUB polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TUB polyclonal antibody (A01)

Brand: Abnova
Reference: H00007275-A01
Product name: TUB polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TUB.
Gene id: 7275
Gene name: TUB
Gene alias: rd5
Gene description: tubby homolog (mouse)
Genbank accession: NM_003320
Immunogen: TUB (NP_003311, 439 a.a. ~ 538 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYN
Protein accession: NP_003311
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007275-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TUB polyclonal antibody (A01) now

Add to cart