TTPA monoclonal antibody (M01), clone 7B5 View larger

TTPA monoclonal antibody (M01), clone 7B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TTPA monoclonal antibody (M01), clone 7B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TTPA monoclonal antibody (M01), clone 7B5

Brand: Abnova
Reference: H00007274-M01
Product name: TTPA monoclonal antibody (M01), clone 7B5
Product description: Mouse monoclonal antibody raised against a partial recombinant TTPA.
Clone: 7B5
Isotype: IgG2a Kappa
Gene id: 7274
Gene name: TTPA
Gene alias: ATTP|AVED|TTP1|alphaTTP
Gene description: tocopherol (alpha) transfer protein
Genbank accession: NM_000370
Immunogen: TTPA (NP_000361.1, 179 a.a. ~ 278 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFPDILPLEYGGEEFSMEDICQEWTNFIMKSEDYLSSISESIQ
Protein accession: NP_000361.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007274-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007274-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged TTPA is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TTPA monoclonal antibody (M01), clone 7B5 now

Add to cart