| Brand: | Abnova |
| Reference: | H00007266-M01 |
| Product name: | DNAJC7 monoclonal antibody (M01), clone 4G6-G3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant DNAJC7. |
| Clone: | 4G6-G3 |
| Isotype: | IgG2a kappa |
| Gene id: | 7266 |
| Gene name: | DNAJC7 |
| Gene alias: | DANJC7|DJ11|TPR2|TTC2 |
| Gene description: | DnaJ (Hsp40) homolog, subfamily C, member 7 |
| Genbank accession: | BC033772 |
| Immunogen: | DNAJC7 (AAH33772, 1 a.a. ~ 484 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG |
| Protein accession: | AAH33772 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (78.98 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DNAJC7 monoclonal antibody (M01), clone 4G6-G3 Western Blot analysis of DNAJC7 expression in Hela ( Cat # L013V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |