Brand: | Abnova |
Reference: | H00007266-D01P |
Product name: | DNAJC7 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human DNAJC7 protein. |
Gene id: | 7266 |
Gene name: | DNAJC7 |
Gene alias: | DANJC7|DJ11|TPR2|TTC2 |
Gene description: | DnaJ (Hsp40) homolog, subfamily C, member 7 |
Genbank accession: | NM_003315 |
Immunogen: | DNAJC7 (NP_003306.1, 1 a.a. ~ 484 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG |
Protein accession: | NP_003306.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | DNAJC7 MaxPab rabbit polyclonal antibody. Western Blot analysis of DNAJC7 expression in human liver. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |