Brand: | Abnova |
Reference: | H00007262-M01 |
Product name: | PHLDA2 monoclonal antibody (M01), clone 5E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PHLDA2. |
Clone: | 5E3 |
Isotype: | IgG2a Kappa |
Gene id: | 7262 |
Gene name: | PHLDA2 |
Gene alias: | BRW1C|BWR1C|HLDA2|IPL|TSSC3 |
Gene description: | pleckstrin homology-like domain, family A, member 2 |
Genbank accession: | NM_003311 |
Immunogen: | PHLDA2 (NP_003302, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDF |
Protein accession: | NP_003302 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PHLDA2 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Characterisation of marsupial PHLDA2 reveals eutherian specific acquisition of imprinting.Suzuki S, Shaw G, Kaneko-Ishino T, Ishino F, Renfree MB. BMC Evol Biol. 2011 Aug 19;11:244. |