Brand: | Abnova |
Reference: | H00007257-M02A |
Product name: | TSNAX monoclonal antibody (M02A), clone 4D5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TSNAX. |
Clone: | 4D5 |
Isotype: | IgM Kappa |
Gene id: | 7257 |
Gene name: | TSNAX |
Gene alias: | TRAX |
Gene description: | translin-associated factor X |
Genbank accession: | NM_005999 |
Immunogen: | TSNAX (NP_005990.1, 191 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS |
Protein accession: | NP_005990.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |