TSC2 monoclonal antibody (M04), clone 1C1 View larger

TSC2 monoclonal antibody (M04), clone 1C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSC2 monoclonal antibody (M04), clone 1C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TSC2 monoclonal antibody (M04), clone 1C1

Brand: Abnova
Reference: H00007249-M04
Product name: TSC2 monoclonal antibody (M04), clone 1C1
Product description: Mouse monoclonal antibody raised against a partial recombinant TSC2.
Clone: 1C1
Isotype: IgG1 Kappa
Gene id: 7249
Gene name: TSC2
Gene alias: FLJ43106|LAM|TSC4
Gene description: tuberous sclerosis 2
Genbank accession: NM_000548
Immunogen: TSC2 (NP_000539, 540 a.a. ~ 658 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SPPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYEMLVSHIQLHYKHSYTLPIASSIRLQAFDFLFLLRADSLHRLGLPNKDGVVRFSPYCVCDYMEPERGSEKK
Protein accession: NP_000539
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007249-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.83 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007249-M04-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged TSC2 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TSC2 monoclonal antibody (M04), clone 1C1 now

Add to cart