| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00007222-A01 |
| Product name: | TRPC3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TRPC3. |
| Gene id: | 7222 |
| Gene name: | TRPC3 |
| Gene alias: | TRP3 |
| Gene description: | transient receptor potential cation channel, subfamily C, member 3 |
| Genbank accession: | NM_003305 |
| Immunogen: | TRPC3 (NP_003296, 485 a.a. ~ 535 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | TARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQ |
| Protein accession: | NP_003296 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.72 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Abnormal expression, localization and interaction of canonical transient receptor potential ion channels in human breast cancer cell lines and tissues: a potential target for breast cancer diagnosis and therapy.Aydar E, Yeo S, Djamgoz M, Palmer C. Cancer Cell Int. 2009 Aug 18;9:23. |