Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TRPC1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TRPC1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00007220-A01 |
| Product name: | TRPC1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TRPC1. |
| Gene id: | 7220 |
| Gene name: | TRPC1 |
| Gene alias: | HTRP-1|MGC133334|MGC133335|TRP1 |
| Gene description: | transient receptor potential cation channel, subfamily C, member 1 |
| Genbank accession: | NM_003304 |
| Immunogen: | TRPC1 (NP_003295, 442 a.a. ~ 505 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | AHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGK |
| Protein accession: | NP_003295 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.15 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Measuring Ca2+ influxes of TRPC1-dependent Ca2+ channels in HL-7702 cells with non-invasive micro-test technique.Zhang ZY, Wang WJ, Pan LJ, Xu Y, Zhang ZM. World J Gastroenterol. 2009 Sep 7;15(33):4150-5 |