Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TRIP6 monoclonal antibody (M04), clone 4B7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about TRIP6 monoclonal antibody (M04), clone 4B7
| Brand: | Abnova |
| Reference: | H00007205-M04 |
| Product name: | TRIP6 monoclonal antibody (M04), clone 4B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIP6. |
| Clone: | 4B7 |
| Isotype: | IgG3 Kappa |
| Gene id: | 7205 |
| Gene name: | TRIP6 |
| Gene alias: | MGC10556|MGC10558|MGC29959|MGC3837|MGC4423|OIP1|ZRP-1 |
| Gene description: | thyroid hormone receptor interactor 6 |
| Genbank accession: | NM_003302 |
| Immunogen: | TRIP6 (NP_003293, 51 a.a. ~ 148 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASP |
| Protein accession: | NP_003293 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TRIP6 monoclonal antibody (M04), clone 4B7 Western Blot analysis of TRIP6 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |