View larger

TRIP6 polyclonal antibody (A02)

Reference:

Condition: New product

Data sheet of TRIP6 polyclonal antibody (A02)

Brand:	Abnova
Reference:	H00007205-A02
Product name:	TRIP6 polyclonal antibody (A02)
Product description:	Mouse polyclonal antibody raised against a partial recombinant TRIP6.
Gene id:	7205
Gene name:	TRIP6
Gene alias:	MGC10556\|MGC10558\|MGC29959\|MGC3837\|MGC4423\|OIP1\|ZRP-1
Gene description:	thyroid hormone receptor interactor 6
Genbank accession:	NM_003302
Immunogen:	TRIP6 (NP_003293, 51 a.a. ~ 148 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASP
Protein accession:	NP_003293
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.89 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	TRIP6 polyclonal antibody (A02), Lot # 060608JCS1 Western Blot analysis of TRIP6 expression in HeLa ( Cat # L013V1 ).
Applications:	WB-Ce,ELISA,WB-Re
Shipping condition:	Dry Ice