Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 374,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 374,00 €
Data sheet of NR2C2 monoclonal antibody (M01), clone 2A5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about NR2C2 monoclonal antibody (M01), clone 2A5
| Brand: | Abnova |
| Reference: | H00007182-M01 |
| Product name: | NR2C2 monoclonal antibody (M01), clone 2A5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NR2C2. |
| Clone: | 2A5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7182 |
| Gene name: | NR2C2 |
| Gene alias: | TAK1|TR2R1|TR4|hTAK1 |
| Gene description: | nuclear receptor subfamily 2, group C, member 2 |
| Genbank accession: | NM_003298 |
| Immunogen: | NR2C2 (NP_003289, 43 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVS |
| Protein accession: | NP_003289 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NR2C2 expression in transfected 293T cell line by NR2C2 monoclonal antibody (M01), clone 2A5. Lane 1: NR2C2 transfected lysate(65.414 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |