| Brand: | Abnova |
| Reference: | H00007178-Q01 |
| Product name: | TPT1 (Human) Recombinant Protein (Q01) |
| Product description: | Human TPT1 partial ORF ( AAH22436, 35 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 7178 |
| Gene name: | TPT1 |
| Gene alias: | FLJ27337|HRF|TCTP|p02 |
| Gene description: | tumor protein, translationally-controlled 1 |
| Genbank accession: | BC022436 |
| Immunogen sequence/protein sequence: | GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC |
| Protein accession: | AAH22436 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Caspase-3-dependent export of TCTP: a novel pathway for antiapoptotic intercellular communication.Sirois I, Raymond MA, Brassard N, Cailhier JF, Fedjaev M, Hamelin K, Londono I, Bendayan M, Pshezhetsky AV, Hebert MJ. Cell Death Differ. 2010 Oct 22. [Epub ahead of print] |