Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TPT1 monoclonal antibody (M01), clone 3C7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA |
More info about TPT1 monoclonal antibody (M01), clone 3C7
| Brand: | Abnova |
| Reference: | H00007178-M01 |
| Product name: | TPT1 monoclonal antibody (M01), clone 3C7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TPT1. |
| Clone: | 3C7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7178 |
| Gene name: | TPT1 |
| Gene alias: | FLJ27337|HRF|TCTP|p02 |
| Gene description: | tumor protein, translationally-controlled 1 |
| Genbank accession: | BC022436 |
| Immunogen: | TPT1 (AAH22436, 35 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC |
| Protein accession: | AAH22436 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TPT1 monoclonal antibody (M01), clone 3C7 Western Blot analysis of TPT1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | TCTP increases stability of hypoxia-inducible factor 1α by interaction with and degradation of the tumor suppressor VHL.Chen K, Chen S, Huang C, Cheng H, Zhou R Biol Cell. 2013 Feb 6. doi: 10.1111/boc.201200080. |