| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00007163-M01 |
| Product name: | TPD52 monoclonal antibody (M01), clone 1B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TPD52. |
| Clone: | 1B6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7163 |
| Gene name: | TPD52 |
| Gene alias: | D52|N8L|PC-1|PrLZ|hD52 |
| Gene description: | tumor protein D52 |
| Genbank accession: | NM_005079 |
| Immunogen: | TPD52 (NP_005070, 100 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL |
| Protein accession: | NP_005070 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.09 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of TPD52 expression in transfected 293T cell line by TPD52 monoclonal antibody (M01), clone 1B6. Lane 1: TPD52 transfected lysate(19.863 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |