Cart 8 Product Products 3 009,35 € (empty)
No products
To be determined Shipping
3 009,35 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 8 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 009,35 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 009,35 €
Data sheet of TPD52 purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about TPD52 purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00007163-B02P |
| Product name: | TPD52 purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human TPD52 protein. |
| Gene id: | 7163 |
| Gene name: | TPD52 |
| Gene alias: | D52|N8L|PC-1|PrLZ|hD52 |
| Gene description: | tumor protein D52 |
| Genbank accession: | NM_005079.2 |
| Immunogen: | TPD52 (NP_005070.1, 1 a.a. ~ 184 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL |
| Protein accession: | NP_005070.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TPD52 expression in transfected 293T cell line (H00007163-T04) by TPD52 MaxPab polyclonal antibody. Lane 1: TPD52 transfected lysate(19.90 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |