Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TPD52 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TPD52 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00007163-A01 |
| Product name: | TPD52 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TPD52. |
| Gene id: | 7163 |
| Gene name: | TPD52 |
| Gene alias: | D52|N8L|PC-1|PrLZ|hD52 |
| Gene description: | tumor protein D52 |
| Genbank accession: | NM_005079 |
| Immunogen: | TPD52 (NP_005070, 100 a.a. ~ 184 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL |
| Protein accession: | NP_005070 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.46 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Expression of chloride intracellular channel protein 1 (CLIC1) and tumor protein D52 (TPD52) as potential biomarkers for colorectal cancer.Petrova DT, Asif AR, Armstrong VW, Dimova I, Toshev S, Yaramov N, Oellerich M, Toncheva D. Clin Biochem. 2008 Oct;41(14-15):1224-36. Epub 2008 Jul 30. |