| Brand:  | Abnova | 
| Reference:  | H00007159-M02A | 
| Product name:  | TP53BP2 monoclonal antibody (M02A), clone 1A10 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant TP53BP2. | 
| Clone:  | 1A10 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 7159 | 
| Gene name:  | TP53BP2 | 
| Gene alias:  | 53BP2|ASPP2|BBP|PPP1R13A|p53BP2 | 
| Gene description:  | tumor protein p53 binding protein, 2 | 
| Genbank accession:  | BC058918 | 
| Immunogen:  | TP53BP2 (AAH58918, 511 a.a. ~ 610 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | PYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYS | 
| Protein accession:  | AAH58918 | 
| Storage buffer:  | In ascites fluid | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.41 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Applications:  | ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |