TP53BP2 monoclonal antibody (M02), clone 1A10 View larger

TP53BP2 monoclonal antibody (M02), clone 1A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TP53BP2 monoclonal antibody (M02), clone 1A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TP53BP2 monoclonal antibody (M02), clone 1A10

Brand: Abnova
Reference: H00007159-M02
Product name: TP53BP2 monoclonal antibody (M02), clone 1A10
Product description: Mouse monoclonal antibody raised against a partial recombinant TP53BP2.
Clone: 1A10
Isotype: IgG2a Kappa
Gene id: 7159
Gene name: TP53BP2
Gene alias: 53BP2|ASPP2|BBP|PPP1R13A|p53BP2
Gene description: tumor protein p53 binding protein, 2
Genbank accession: BC058918
Immunogen: TP53BP2 (AAH58918, 511 a.a. ~ 610 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYS
Protein accession: AAH58918
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007159-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007159-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged TP53BP2 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TP53BP2 monoclonal antibody (M02), clone 1A10 now

Add to cart