| Brand: | Abnova |
| Reference: | H00007159-M02 |
| Product name: | TP53BP2 monoclonal antibody (M02), clone 1A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TP53BP2. |
| Clone: | 1A10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7159 |
| Gene name: | TP53BP2 |
| Gene alias: | 53BP2|ASPP2|BBP|PPP1R13A|p53BP2 |
| Gene description: | tumor protein p53 binding protein, 2 |
| Genbank accession: | BC058918 |
| Immunogen: | TP53BP2 (AAH58918, 511 a.a. ~ 610 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYS |
| Protein accession: | AAH58918 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TP53BP2 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |