TP53BP1 polyclonal antibody (A01) View larger

TP53BP1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TP53BP1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TP53BP1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00007158-A01
Product name: TP53BP1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TP53BP1.
Gene id: 7158
Gene name: TP53BP1
Gene alias: 53BP1|FLJ41424|MGC138366|p202
Gene description: tumor protein p53 binding protein 1
Genbank accession: NM_005657
Immunogen: TP53BP1 (NP_005648, 1766 a.a. ~ 1874 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKV
Protein accession: NP_005648
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007158-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TP53BP1 polyclonal antibody (A01) now

Add to cart