Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TP53 monoclonal antibody (M04), clone 2C11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab,PLA-Ce |
More info about TP53 monoclonal antibody (M04), clone 2C11
| Brand: | Abnova |
| Reference: | H00007157-M04 |
| Product name: | TP53 monoclonal antibody (M04), clone 2C11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TP53. |
| Clone: | 2C11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7157 |
| Gene name: | TP53 |
| Gene alias: | FLJ92943|LFS1|TRP53|p53 |
| Gene description: | tumor protein p53 |
| Genbank accession: | BC003596 |
| Immunogen: | TP53 (AAH03596, 94 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNL |
| Protein accession: | AAH03596 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TP53 monoclonal antibody (M04), clone 2C11 Western Blot analysis of TP53 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab,PLA-Ce |
| Shipping condition: | Dry Ice |