| Brand: | Abnova |
| Reference: | H00007153-M01 |
| Product name: | TOP2A monoclonal antibody (M01), clone 1E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TOP2A. |
| Clone: | 1E2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7153 |
| Gene name: | TOP2A |
| Gene alias: | TOP2|TP2A |
| Gene description: | topoisomerase (DNA) II alpha 170kDa |
| Genbank accession: | NM_001067 |
| Immunogen: | TOP2A (NP_001058, 1435 a.a. ~ 1531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF |
| Protein accession: | NP_001058 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to TOP2A on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Chromosome Scaffold is a Double-Stranded Assembly of Scaffold Proteins.Poonperm R, Takata H, Hamano T, Matsuda A, Uchiyama S, Hiraoka Y, Fukui K. Sci Rep. 2015 Jul 1;5:11916. |