| Brand: | Abnova |
| Reference: | H00007150-M01 |
| Product name: | TOP1 monoclonal antibody (M01), clone 1A1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TOP1. |
| Clone: | 1A1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7150 |
| Gene name: | TOP1 |
| Gene alias: | TOPI |
| Gene description: | topoisomerase (DNA) I |
| Genbank accession: | NM_003286 |
| Immunogen: | TOP1 (NP_003277, 692 a.a. ~ 765 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF |
| Protein accession: | NP_003277 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.88 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | AID-induced decrease in topoisomerase 1 induces DNA structural alteration and DNA cleavage for class switch recombination.Kobayashi M, Aida M, Nagaoka H, Begum NA, Kitawaki Y, Nakata M, Stanlie A, Doi T, Kato L, Okazaki IM, Shinkura R, Muramatsu M, Kinoshita K, Honjo T. Proc Natl Acad Sci U S A. 2009 Dec 29;106(52):22375-80. Epub 2009 Dec 11. |