Brand: | Abnova |
Reference: | H00007141-M04A |
Product name: | TNP1 monoclonal antibody (M04A), clone 4F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNP1. |
Clone: | 4F12 |
Isotype: | IgM Kappa |
Gene id: | 7141 |
Gene name: | TNP1 |
Gene alias: | TP1 |
Gene description: | transition protein 1 (during histone to protamine replacement) |
Genbank accession: | NM_003284 |
Immunogen: | TNP1 (NP_003275.1, 1 a.a. ~ 55 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL |
Protein accession: | NP_003275.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |