Cart 21 Product Products 8 241,54 € (empty)
-
-
-
1 x Nup160...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
8 241,54 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 21 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 8 241,54 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 8 241,54 €
Data sheet of TNP1 monoclonal antibody (M04A), clone 4F12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about TNP1 monoclonal antibody (M04A), clone 4F12
| Brand: | Abnova |
| Reference: | H00007141-M04A |
| Product name: | TNP1 monoclonal antibody (M04A), clone 4F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNP1. |
| Clone: | 4F12 |
| Isotype: | IgM Kappa |
| Gene id: | 7141 |
| Gene name: | TNP1 |
| Gene alias: | TP1 |
| Gene description: | transition protein 1 (during histone to protamine replacement) |
| Genbank accession: | NM_003284 |
| Immunogen: | TNP1 (NP_003275.1, 1 a.a. ~ 55 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL |
| Protein accession: | NP_003275.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |