Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TNP1 monoclonal antibody (M01), clone 1B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re |
More info about TNP1 monoclonal antibody (M01), clone 1B5
| Brand: | Abnova |
| Reference: | H00007141-M01 |
| Product name: | TNP1 monoclonal antibody (M01), clone 1B5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TNP1. |
| Clone: | 1B5 |
| Isotype: | IgG2b kappa |
| Gene id: | 7141 |
| Gene name: | TNP1 |
| Gene alias: | TP1 |
| Gene description: | transition protein 1 (during histone to protamine replacement) |
| Genbank accession: | BC029516 |
| Immunogen: | TNP1 (AAH29516.1, 1 a.a. ~ 55 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL |
| Protein accession: | AAH29516.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.79 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to TNP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |