TNNT3 monoclonal antibody (M03A), clone 1H4 View larger

TNNT3 monoclonal antibody (M03A), clone 1H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNNT3 monoclonal antibody (M03A), clone 1H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about TNNT3 monoclonal antibody (M03A), clone 1H4

Brand: Abnova
Reference: H00007140-M03A
Product name: TNNT3 monoclonal antibody (M03A), clone 1H4
Product description: Mouse monoclonal antibody raised against a partial recombinant TNNT3.
Clone: 1H4
Isotype: IgM Kappa
Gene id: 7140
Gene name: TNNT3
Gene alias: AMCD2B|DA2B|DKFZp779M2348|FSSV
Gene description: troponin T type 3 (skeletal, fast)
Genbank accession: NM_006757
Immunogen: TNNT3 (NP_006748, 161 a.a. ~ 258 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK
Protein accession: NP_006748
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007140-M03A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00007140-M03A-1-11-1.jpg
Application image note: TNNT3 monoclonal antibody (M03A), clone 1H4. Western Blot analysis of TNNT3 expression in PC-12.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TNNT3 monoclonal antibody (M03A), clone 1H4 now

Add to cart