Brand: | Abnova |
Reference: | H00007140-M03A |
Product name: | TNNT3 monoclonal antibody (M03A), clone 1H4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNNT3. |
Clone: | 1H4 |
Isotype: | IgM Kappa |
Gene id: | 7140 |
Gene name: | TNNT3 |
Gene alias: | AMCD2B|DA2B|DKFZp779M2348|FSSV |
Gene description: | troponin T type 3 (skeletal, fast) |
Genbank accession: | NM_006757 |
Immunogen: | TNNT3 (NP_006748, 161 a.a. ~ 258 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK |
Protein accession: | NP_006748 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | TNNT3 monoclonal antibody (M03A), clone 1H4. Western Blot analysis of TNNT3 expression in PC-12. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |