Cart 35 Product Products 13 180,50 € (empty)
No products
To be determined Shipping
13 180,50 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 35 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 13 180,50 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 13 180,50 €
Data sheet of TNNT3 monoclonal antibody (M03A), clone 1H4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about TNNT3 monoclonal antibody (M03A), clone 1H4
| Brand: | Abnova |
| Reference: | H00007140-M03A |
| Product name: | TNNT3 monoclonal antibody (M03A), clone 1H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNNT3. |
| Clone: | 1H4 |
| Isotype: | IgM Kappa |
| Gene id: | 7140 |
| Gene name: | TNNT3 |
| Gene alias: | AMCD2B|DA2B|DKFZp779M2348|FSSV |
| Gene description: | troponin T type 3 (skeletal, fast) |
| Genbank accession: | NM_006757 |
| Immunogen: | TNNT3 (NP_006748, 161 a.a. ~ 258 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK |
| Protein accession: | NP_006748 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | TNNT3 monoclonal antibody (M03A), clone 1H4. Western Blot analysis of TNNT3 expression in PC-12. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |