Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TNNT3 monoclonal antibody (M02), clone 1F12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about TNNT3 monoclonal antibody (M02), clone 1F12
| Brand: | Abnova |
| Reference: | H00007140-M02 |
| Product name: | TNNT3 monoclonal antibody (M02), clone 1F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNNT3. |
| Clone: | 1F12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7140 |
| Gene name: | TNNT3 |
| Gene alias: | AMCD2B|DA2B|DKFZp779M2348|FSSV |
| Gene description: | troponin T type 3 (skeletal, fast) |
| Genbank accession: | NM_006757 |
| Immunogen: | TNNT3 (NP_006748, 161 a.a. ~ 258 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK |
| Protein accession: | NP_006748 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TNNT3 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Proteome dynamics during contractile and metabolic differentiation of bovine foetal muscle.Chaze T, Meunier B, Chambon C, Jurie C, Picard B. Animal (2009) doi:10.1017 /S1751731 109004315 |