Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TNNT1 purified MaxPab rabbit polyclonal antibody (D02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about TNNT1 purified MaxPab rabbit polyclonal antibody (D02P)
| Brand: | Abnova |
| Reference: | H00007138-D02P |
| Product name: | TNNT1 purified MaxPab rabbit polyclonal antibody (D02P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human TNNT1 protein. |
| Gene id: | 7138 |
| Gene name: | TNNT1 |
| Gene alias: | ANM|FLJ98147|MGC104241|STNT|TNT|TNTS |
| Gene description: | troponin T type 1 (skeletal, slow) |
| Genbank accession: | BC010963 |
| Immunogen: | TNNT1 (AAH10963.1, 1 a.a. ~ 262 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK |
| Protein accession: | AAH10963.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | TNNT1 MaxPab rabbit polyclonal antibody. Western Blot analysis of TNNT1 expression in human placenta. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |