TNNT1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

TNNT1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNNT1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about TNNT1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00007138-D01P
Product name: TNNT1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human TNNT1 protein.
Gene id: 7138
Gene name: TNNT1
Gene alias: ANM|FLJ98147|MGC104241|STNT|TNT|TNTS
Gene description: troponin T type 1 (skeletal, slow)
Genbank accession: NM_003283.1
Immunogen: TNNT1 (NP_003274.1, 1 a.a. ~ 251 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSDTEEQEYEEEQPEEEAAEEEEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK
Protein accession: NP_003274.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00007138-D01P-13-15-1.jpg
Application image note: Western Blot analysis of TNNT1 expression in transfected 293T cell line (H00007138-T02) by TNNT1 MaxPab polyclonal antibody.

Lane 1: TNNT1 transfected lysate(27.61 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TNNT1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart