Cart 50 Product Products 18 728,40 € (empty)
No products
To be determined Shipping
18 728,40 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 50 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 18 728,40 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 18 728,40 €
Data sheet of TNNI3 monoclonal antibody (M04), clone 1E7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about TNNI3 monoclonal antibody (M04), clone 1E7
| Brand: | Abnova |
| Reference: | H00007137-M04 |
| Product name: | TNNI3 monoclonal antibody (M04), clone 1E7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNNI3. |
| Clone: | 1E7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7137 |
| Gene name: | TNNI3 |
| Gene alias: | CMD2A|CMH7|MGC116817|RCM1|TNNC1|cTnI |
| Gene description: | troponin I type 3 (cardiac) |
| Genbank accession: | NM_000363 |
| Immunogen: | TNNI3 (NP_000354, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES |
| Protein accession: | NP_000354 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of TNNI3 over-expressed 293 cell line, cotransfected with TNNI3 Validated Chimera RNAi ( Cat # H00007137-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TNNI3 monoclonal antibody (M04), clone 1E7 (Cat # H00007137-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C.Uys GM, Ramburan A, Loos B, Kinnear CJ, Korkie LJ, Mouton J, Riedemann J, Moolman-Smook JC. BMC Cell Biol. 2011 May 10;12:18. |