No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00007134-M01 |
| Product name: | TNNC1 monoclonal antibody (M01), clone 1F8-A9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TNNC1. |
| Clone: | 1F8-A9 |
| Isotype: | IgG1 kappa |
| Gene id: | 7134 |
| Gene name: | TNNC1 |
| Gene alias: | CMD1Z|TNC|TNNC |
| Gene description: | troponin C type 1 (slow) |
| Genbank accession: | BC030244 |
| Immunogen: | TNNC1 (AAH30244, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE |
| Protein accession: | AAH30244 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (43.45 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoperoxidase of monoclonal antibody to TNNC1 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |