No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | S-ELISA,ELISA,WB-Re | 
| Brand: | Abnova | 
| Reference: | H00007127-M01 | 
| Product name: | TNFAIP2 monoclonal antibody (M01), clone 7H1 | 
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFAIP2. | 
| Clone: | 7H1 | 
| Isotype: | IgG2a Kappa | 
| Gene id: | 7127 | 
| Gene name: | TNFAIP2 | 
| Gene alias: | B94 | 
| Gene description: | tumor necrosis factor, alpha-induced protein 2 | 
| Genbank accession: | NM_006291 | 
| Immunogen: | TNFAIP2 (NP_006282, 552 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | YILANADTIQHFCTQHGSPATWLQPALPTLAEIIRLQDPSAIKIEVATYATCYPDFSKGHLSAILAIKGNLSNSEVKRIRSILDVSMGAQEPSRPLFSL | 
| Protein accession: | NP_006282 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Detection limit for recombinant GST tagged TNFAIP2 is 3 ng/ml as a capture antibody. | 
| Applications: | S-ELISA,ELISA,WB-Re | 
| Shipping condition: | Dry Ice |