| Brand:  | Abnova | 
| Reference:  | H00007124-M04 | 
| Product name:  | TNF monoclonal antibody (M04), clone M2-E3 | 
| Product description:  | Mouse monoclonal antibody raised against a full length recombinant TNF. | 
| Clone:  | M2-E3 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 7124 | 
| Gene name:  | TNF | 
| Gene alias:  | DIF|TNF-alpha|TNFA|TNFSF2 | 
| Gene description:  | tumor necrosis factor (TNF superfamily, member 2) | 
| Genbank accession:  | BC028148 | 
| Immunogen:  | TNF (AAH28148, 1 a.a. ~ 233 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL | 
| Protein accession:  | AAH28148 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (51.37 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged TNF is 0.1 ng/ml as a capture antibody. | 
| Applications:  | S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |