Brand: | Abnova |
Reference: | H00007124-M02 |
Product name: | TNF monoclonal antibody (M02), clone 1C3-A1-F4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant TNF. |
Clone: | 1C3-A1-F4 |
Isotype: | IgG1 kappa |
Gene id: | 7124 |
Gene name: | TNF |
Gene alias: | DIF|TNF-alpha|TNFA|TNFSF2 |
Gene description: | tumor necrosis factor (TNF superfamily, member 2) |
Genbank accession: | BC028148 |
Immunogen: | TNF (AAH28148, 1 a.a. ~ 233 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
Protein accession: | AAH28148 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (51.37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TNF is approximately 0.03ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |