Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TNF polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about TNF polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00007124-A01 |
| Product name: | TNF polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TNF. |
| Gene id: | 7124 |
| Gene name: | TNF |
| Gene alias: | DIF|TNF-alpha|TNFA|TNFSF2 |
| Gene description: | tumor necrosis factor (TNF superfamily, member 2) |
| Genbank accession: | NM_000594 |
| Immunogen: | TNF (NP_000585, 124 a.a. ~ 233 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
| Protein accession: | NP_000585 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |