TMPRSS2 monoclonal antibody (M05), clone 2F4 View larger

TMPRSS2 monoclonal antibody (M05), clone 2F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMPRSS2 monoclonal antibody (M05), clone 2F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TMPRSS2 monoclonal antibody (M05), clone 2F4

Brand: Abnova
Reference: H00007113-M05
Product name: TMPRSS2 monoclonal antibody (M05), clone 2F4
Product description: Mouse monoclonal antibody raised against a partial recombinant TMPRSS2.
Clone: 2F4
Isotype: IgG2a Kappa
Gene id: 7113
Gene name: TMPRSS2
Gene alias: FLJ41954|PP9284|PRSS10
Gene description: transmembrane protease, serine 2
Genbank accession: NM_005656
Immunogen: TMPRSS2 (NP_005647, 383 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Protein accession: NP_005647
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007113-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007113-M05-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged TMPRSS2 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TMPRSS2 monoclonal antibody (M05), clone 2F4 now

Add to cart