| Brand:  | Abnova | 
| Reference:  | H00007109-M02 | 
| Product name:  | TMEM1 monoclonal antibody (M02), clone 5D5 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant TMEM1. | 
| Clone:  | 5D5 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 7109 | 
| Gene name:  | TRAPPC10 | 
| Gene alias:  | EHOC-1|EHOC1|FLJ54223|FLJ54817|FLJ55683|GT334|MGC126777|TMEM1|TRS130|TRS30 | 
| Gene description:  | trafficking protein particle complex 10 | 
| Genbank accession:  | NM_003274 | 
| Immunogen:  | TMEM1 (NP_003265, 1162 a.a. ~ 1257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS | 
| Protein accession:  | NP_003265 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.3 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | TMEM1 monoclonal antibody (M02), clone 5D5. Western Blot analysis of TMEM1 expression in Hela S3 NE ( Cat # L013V3 ). | 
| Applications:  | WB-Ce,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |