| Brand: | Abnova |
| Reference: | H00007109-M02 |
| Product name: | TMEM1 monoclonal antibody (M02), clone 5D5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TMEM1. |
| Clone: | 5D5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7109 |
| Gene name: | TRAPPC10 |
| Gene alias: | EHOC-1|EHOC1|FLJ54223|FLJ54817|FLJ55683|GT334|MGC126777|TMEM1|TRS130|TRS30 |
| Gene description: | trafficking protein particle complex 10 |
| Genbank accession: | NM_003274 |
| Immunogen: | TMEM1 (NP_003265, 1162 a.a. ~ 1257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS |
| Protein accession: | NP_003265 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TMEM1 monoclonal antibody (M02), clone 5D5. Western Blot analysis of TMEM1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |