| Brand: | Abnova |
| Reference: | H00007109-M01 |
| Product name: | TMEM1 monoclonal antibody (M01), clone 5B4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TMEM1. |
| Clone: | 5B4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7109 |
| Gene name: | TRAPPC10 |
| Gene alias: | EHOC-1|EHOC1|FLJ54223|FLJ54817|FLJ55683|GT334|MGC126777|TMEM1|TRS130|TRS30 |
| Gene description: | trafficking protein particle complex 10 |
| Genbank accession: | NM_003274 |
| Immunogen: | TMEM1 (NP_003265, 1162 a.a. ~ 1257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS |
| Protein accession: | NP_003265 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of TMEM1 over-expressed 293 cell line, cotransfected with TMEM1 Validated Chimera RNAi ( Cat # H00007109-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TMEM1 monoclonal antibody (M01), clone 5B4 (Cat # H00007109-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | TRAPPC9 Mediates the Interaction between p150 and COPII Vesicles at the Target Membrane.Zong M, Satoh A, Yu MK, Siu KY, Ng WY, Chan HC, Tanner JA, Yu S. PLoS One. 2012;7(1):e29995. Epub 2012 Jan 18. |