Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TSPAN8 monoclonal antibody (M02), clone 1E5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about TSPAN8 monoclonal antibody (M02), clone 1E5
| Brand: | Abnova |
| Reference: | H00007103-M02 |
| Product name: | TSPAN8 monoclonal antibody (M02), clone 1E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TSPAN8. |
| Clone: | 1E5 |
| Isotype: | IgG3 Lambda |
| Gene id: | 7103 |
| Gene name: | TSPAN8 |
| Gene alias: | CO-029|TM4SF3 |
| Gene description: | tetraspanin 8 |
| Genbank accession: | NM_004616 |
| Immunogen: | TSPAN8 (NP_004607, 110 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN |
| Protein accession: | NP_004607 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged TSPAN8 is approximately 10ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | TM4SF3 promotes esophageal carcinoma metastasis via upregulating ADAM12m expression.Zhou Z, Ran YL, Hu H, Pan J, Li ZF, Chen LZ, Sun LC, Peng L, Zhao XL, Yu L, Sun LX, Yang ZH. Clin Exp Metastasis. 2008;25(5):537-48. Epub 2008 Mar 26. |