NR2E1 monoclonal antibody (M03A), clone 4G12 View larger

NR2E1 monoclonal antibody (M03A), clone 4G12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NR2E1 monoclonal antibody (M03A), clone 4G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,ELISA

More info about NR2E1 monoclonal antibody (M03A), clone 4G12

Brand: Abnova
Reference: H00007101-M03A
Product name: NR2E1 monoclonal antibody (M03A), clone 4G12
Product description: Mouse monoclonal antibody raised against a partial recombinant NR2E1.
Clone: 4G12
Isotype: IgG2a Kappa
Gene id: 7101
Gene name: NR2E1
Gene alias: TLL|TLX|XTLL
Gene description: nuclear receptor subfamily 2, group E, member 1
Genbank accession: NM_003269
Immunogen: NR2E1 (NP_003260, 249 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGK
Protein accession: NP_003260
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00007101-M03A-1-8-1.jpg
Application image note: NR2E1 monoclonal antibody (M03A), clone 4G12. Western Blot analysis of NR2E1 expression in NIH/3T3.
Applications: WB-Ce,ELISA
Shipping condition: Dry Ice

Reviews

Buy NR2E1 monoclonal antibody (M03A), clone 4G12 now

Add to cart