NR2E1 monoclonal antibody (M02A), clone 2D10 View larger

NR2E1 monoclonal antibody (M02A), clone 2D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NR2E1 monoclonal antibody (M02A), clone 2D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about NR2E1 monoclonal antibody (M02A), clone 2D10

Brand: Abnova
Reference: H00007101-M02A
Product name: NR2E1 monoclonal antibody (M02A), clone 2D10
Product description: Mouse monoclonal antibody raised against a partial recombinant NR2E1.
Clone: 2D10
Isotype: IgG2a Kappa
Gene id: 7101
Gene name: NR2E1
Gene alias: TLL|TLX|XTLL
Gene description: nuclear receptor subfamily 2, group E, member 1
Genbank accession: NM_003269
Immunogen: NR2E1 (NP_003260, 249 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGK
Protein accession: NP_003260
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy NR2E1 monoclonal antibody (M02A), clone 2D10 now

Add to cart