Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NR2E1 monoclonal antibody (M01), clone 1C4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA |
More info about NR2E1 monoclonal antibody (M01), clone 1C4
| Brand: | Abnova |
| Reference: | H00007101-M01 |
| Product name: | NR2E1 monoclonal antibody (M01), clone 1C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NR2E1. |
| Clone: | 1C4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7101 |
| Gene name: | NR2E1 |
| Gene alias: | TLL|TLX|XTLL |
| Gene description: | nuclear receptor subfamily 2, group E, member 1 |
| Genbank accession: | NM_003269 |
| Immunogen: | NR2E1 (NP_003260, 249 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGK |
| Protein accession: | NP_003260 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | NR2E1 monoclonal antibody (M01), clone 1C4 Western Blot analysis of NR2E1 expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |