Cart 1 Product Products 369,00 € (empty)
No products
To be determined Shipping
369,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 369,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 369,00 €
Data sheet of TLR5 monoclonal antibody (M07A), clone 1E1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TLR5 monoclonal antibody (M07A), clone 1E1
| Brand: | Abnova |
| Reference: | H00007100-M07A |
| Product name: | TLR5 monoclonal antibody (M07A), clone 1E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TLR5. |
| Clone: | 1E1 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7100 |
| Gene name: | TLR5 |
| Gene alias: | FLJ10052|MGC126430|MGC126431|SLEB1|TIL3 |
| Gene description: | toll-like receptor 5 |
| Genbank accession: | NM_003268 |
| Immunogen: | TLR5 (NP_003259, 517 a.a. ~ 634 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEV |
| Protein accession: | NP_003259 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.72 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |