| Brand:  | Abnova | 
| Reference:  | H00007100-M06 | 
| Product name:  | TLR5 monoclonal antibody (M06), clone 1A11 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant TLR5. | 
| Clone:  | 1A11 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 7100 | 
| Gene name:  | TLR5 | 
| Gene alias:  | FLJ10052|MGC126430|MGC126431|SLEB1|TIL3 | 
| Gene description:  | toll-like receptor 5 | 
| Genbank accession:  | NM_003268 | 
| Immunogen:  | TLR5 (NP_003259, 517 a.a. ~ 634 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEV | 
| Protein accession:  | NP_003259 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (38.72 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged TLR5 is approximately 0.1ng/ml as a capture antibody. | 
| Applications:  | S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |