TLR5 monoclonal antibody (M05), clone 3H6 View larger

TLR5 monoclonal antibody (M05), clone 3H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLR5 monoclonal antibody (M05), clone 3H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TLR5 monoclonal antibody (M05), clone 3H6

Brand: Abnova
Reference: H00007100-M05
Product name: TLR5 monoclonal antibody (M05), clone 3H6
Product description: Mouse monoclonal antibody raised against a partial recombinant TLR5.
Clone: 3H6
Isotype: IgG2b Kappa
Gene id: 7100
Gene name: TLR5
Gene alias: FLJ10052|MGC126430|MGC126431|SLEB1|TIL3
Gene description: toll-like receptor 5
Genbank accession: NM_003268
Immunogen: TLR5 (NP_003259, 517 a.a. ~ 634 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEV
Protein accession: NP_003259
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007100-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.72 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007100-M05-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TLR5 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TLR5 monoclonal antibody (M05), clone 3H6 now

Add to cart