No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00007100-M04A |
Product name: | TLR5 monoclonal antibody (M04A), clone 4G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TLR5. |
Clone: | 4G5 |
Isotype: | IgG2b Kappa |
Gene id: | 7100 |
Gene name: | TLR5 |
Gene alias: | FLJ10052|MGC126430|MGC126431|SLEB1|TIL3 |
Gene description: | toll-like receptor 5 |
Genbank accession: | NM_003268 |
Immunogen: | TLR5 (NP_003259, 517 a.a. ~ 634 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEV |
Protein accession: | NP_003259 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.72 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |