Cart 20 Product Products 6 977,65 € (empty)
-
-
-
-
-
-
1 x Horse Ig...137,00 € -
-
-
-
-
-
![Deoxyribonuclease I [DNase I] Ribonuclease & Protease free](https://www.proteogenix-products.com/32474-cart_default/deoxyribonuclease-i-dnase-i-ribonuclease-protease-free.jpg)
-
-
-
-
-
-
-
-
No products
To be determined Shipping
6 977,65 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 20 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 977,65 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 977,65 €
Data sheet of TLR4 monoclonal antibody (M16), clone 3G12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TLR4 monoclonal antibody (M16), clone 3G12
| Brand: | Abnova |
| Reference: | H00007099-M16 |
| Product name: | TLR4 monoclonal antibody (M16), clone 3G12 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TLR4. |
| Clone: | 3G12 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7099 |
| Gene name: | TLR4 |
| Gene alias: | ARMD10|CD284|TOLL|hToll |
| Gene description: | toll-like receptor 4 |
| Genbank accession: | NM_138554 |
| Immunogen: | TLR4 (NP_612564.1, 130 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQM |
| Protein accession: | NP_612564.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.55 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |