Cart 1 Product Products 369,00 € (empty)
No products
To be determined Shipping
369,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 369,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 369,00 €
Data sheet of TLR4 monoclonal antibody (M03A), clone 1H7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about TLR4 monoclonal antibody (M03A), clone 1H7
| Brand: | Abnova |
| Reference: | H00007099-M03A |
| Product name: | TLR4 monoclonal antibody (M03A), clone 1H7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TLR4. |
| Clone: | 1H7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7099 |
| Gene name: | TLR4 |
| Gene alias: | ARMD10|CD284|TOLL|hToll |
| Gene description: | toll-like receptor 4 |
| Genbank accession: | NM_138554 |
| Immunogen: | TLR4 (NP_612564, 214 a.a. ~ 291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLA |
| Protein accession: | NP_612564 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |