No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
| Brand: | Abnova |
| Reference: | H00007097-M08 |
| Product name: | TLR2 monoclonal antibody (M08), clone 4G9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TLR2. |
| Clone: | 4G9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7097 |
| Gene name: | TLR2 |
| Gene alias: | CD282|TIL4 |
| Gene description: | toll-like receptor 2 |
| Genbank accession: | BC033756.1 |
| Immunogen: | TLR2 (AAH33756.1, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDV |
| Protein accession: | AAH33756.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |